-
Add to Cart The item has been added617-109-007Monkey IgM Antibody Texas Red 1mg
Price: $386.04List Price: $428.93This product is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. This product is also suitable for multiplex analysis, including multicolor imaging, utilizing various commercial -
Add to Cart The item has been addedF4641-.2MLSigma-Aldrich
Monoclonal Anti-Human IgG3-FITC antibody produced in mouse
Price: $783.43List Price: $870.48Human Immunoglobulin G consists of four subclasses, namely IgG1, IgG2, IgG3, and IgG4, named ⓿, ─, ━, and │, respectively. The primary structure of the antibody contains disulfide bonds involved in linking the two heavy -
Add to Cart The item has been addedAMAB91460-100ULSigma-Aldrich
Monoclonal Anti-ITGA1 antibody produced in mouse (C15-1318-868)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to Integrin subunit alpha 1 Sequence RQISRSFFSGTQERKVQRN Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedAMAB91461-100ULSigma-Aldrich
Monoclonal Anti-ITGA1 antibody produced in mouse (C15-1318-869)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to Integrin subunit alpha 1 Sequence RQISRSFFSGTQERKVQRN Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedAMAB91446-100ULSigma-Aldrich
Monoclonal Anti-ITGA3 antibody produced in mouse (C15-1318-857)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to integrin subunit alpha 3 Sequence AQALENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNTRTSERSGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAFEVIGV Application All Prestige Antibodies -
Add to Cart The item has been addedAMAB91468-100ULSigma-Aldrich
Monoclonal Anti-ITGA8 antibody produced in mouse (C15-1318-871)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to integrin subunit alpha 8 Sequence HKEEEVGPLVEHIYELHNIGPSTISDTILEVGWPFSARDEFLLYIFHIQTLGPLQCQPNPNINPQDIKPAASPEDTPELSAFLRNSTIPHLVRKRDVHVVEFHRQSPAKILNCTNIECLQISCA Application All Prestige Antibodies -
Add to Cart The item has been added85022106-1VLCell Line Origin Mouse myeloma Cell Line Description Established in vitro from the MOPC 315 plasmacytoma induced by mineral oil injections in a BALB/c mouse. Secretes an IgA lambda antibody which recognises DNP-TNP substituted proteins. -
Add to Cart The item has been added4275MORF4 Antibody, 100 ug UN1687
Price: $623.39List Price: $692.66HOST SPECIES: Rabbit CLONALITY: Polyclonal TESTED APPLICATIONS: E, WB, IHC-P, IF APPLICATIONS: MORF4 antibody can be used for the detection of MORF4 by Western blot at 1 and 2 μg/mL. Antibody can also be used for immunohistochemistry starting -
Add to Cart The item has been added610-4210Mouse ? (kappa chain) Antibody FITC 1mg
Price: $395.97List Price: $439.96This product is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. This product is also suitable for multiplex analysis, including multicolor imaging, utilizing various commercial -
Add to Cart The item has been added8641462Mouse IgG 100mg
Price: $1,109.64List Price: $1,232.94This immunoglobulin was prepared from mouse serum using current chromatographic techniques. A quantitative protein analysis as well as immunoelectrophoresis has been applied to determine identity of the product. -
Add to Cart The item has been addedAb180307-100μgApplication:Flow: ≤1μg/test:For flow cytometric staining, the suggested use of this reagent is ≤1 μg per million cells in 100 µL staining volume or 100 µL of whole blood. -
Add to Cart The item has been addedAb180307-25μgApplication:Flow: ≤1μg/test:For flow cytometric staining, the suggested use of this reagent is ≤1 μg per million cells in 100 µL staining volume or 100 µL of whole blood.
