Antibody Purification Kit Components

BACE-1 (&#946-site APP cleaving enzyme, Asp2 or memapsin 2) is known as &#946-secretase. BACE-1 is highly expressed in neurons, the major site of A&#946 generation.

The membrane-associated aspartic protease BACE-1 (&#946-site APP cleaving enzyme, Asp2 or memapsin 2) has been identified as &#946-secretase. BACE-1 constitutes the predominant &#946-secretase activity in human brain tissue.

Bcl2-associated athanogene 3 (BAG3), also known as CAIR-1 or Bis, belongs to a family of six evolutionarily conserved co-chaperone proteins that contain a characteristic C-terminal BAG domain. In most cell types, BAG3 is localized to the cytoplasm,

BAG (BCL2 associated athanogene) family molecular chaperone regulator-3 (BAG3) is a member of BAG family of co-chaperones that interacts with Hsp70 (Heat shock protein 70). Immunogen BAG family molecular chaperone regulator 3 recombinant protein

Immunogen BAG family molecular chaperone regulator 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen BAH domain and coiled-coil containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to BAH domain and coiled-coil containing 1 Sequence SGLDKSGYFELPTSSQDCARPGHQDPLGGKAPQACCTLDKTVGKEAPAGPPGAQKVARIRHQQHLMAAEVEQGGIGAEAKRKSLELA Application All Prestige Antibodies Powered by Atlas Antibodies

Bone morphogenic protein and activin membrane-bound inhibitor (BAMBI) is a transmembrane glycoprotein which is a pseudo receptor belonging to the family of TGF-&#946 (transforming growth factor beta receptor) type I receptors. BAMBI is

BAMBI (bone morphogenetic protein and activin membrane-bound inhibitor) is a pseudoreceptor of TGF-&#946, and is highly conserved in vertebrates. This protein is a transmembrane glycoprotein and shows homology with TGF-&#946 type I receptors.

Immunogen B-cell scaffold protein with ankyrin repeats 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen BTG3 associated nuclear protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen BARX homeobox 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.