Antibody Purification Kit Components

Immunogen mucin 1 isoform 5 precursor recombinant protein epitope signature tag (PrEST) Sequence AVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL Application Anti-MUC1 antibody produced in rabbit, a Prestige Antibody, is

The gene MUC13 (mucin 13) is mapped to human chromosome 3q21. The gene encodes a transmembrane O -linked glycoprotein.

Mucin-15 (MUC15) is a type-I membrane-bound glycoprotein. The gene encoding it is localized on human chromosome 11p14.

Immunogen mucin 15, cell surface associated Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen mucin 21, cell surface associated recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Mucin-4 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen mucin 5AC, oligomeric mucus/gel-forming Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Mucin 5B (MUC5B) gene is mapped to human chromosome 11p15.5.

Immunogen MUM1-like protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Mutated melanoma-associated antigen 1-like protein 1 (MUM1L1) can exist in four splice variants. It possesses a mutated melanoma-associated antigen 1 domain.

MX1 (Myxoma resistance protein 1) gene is mapped to human chromosome 21q22.3.

Immunogen MX dynamin-like GTPase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the