Antibody Purification Kit Components

Immunogen neurogenin 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

NFATC4 is a part of a transcriptional complex and belongs to the nuclear factor of activated T cells (NFAT) family of proteins. NFATc4 has been implicated in calcineurin-induced cardiac hypertrophy.

Immunogen Synthetic peptide directed towards the N terminal region of human NFATC4 Biochem/physiol Actions NFATC4 is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two

NFATC4 forms a part of a DNA-binding transcription complex that consists of inducible cytosolic and nuclear components. NFATC4 is involved in modulating neurotrophin-mediated synaptic plasticity and can also induce interleukins 2 and 4.

Immunogen nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

NFIA is a transcription factor that regulates gliogenesis during spinal cord development. Haploinsufficeincy of NFIA has been linked to urinary tract defects and CNS malformation syndrome.

Immunogen Nuclear factor 1 A-type recombinant protein epitope signature tag (PrEST) Sequence LKSVEDEMDSPGEEPFYTGQGRSPGSGSQSSGWHEVEPGMPSPTTLKKSEKSGFSSPSPSQTSSLGTAFTQHHRPVITGPRASPHATPSTLHFPTSPIIQQ Application All Prestige Antibodies Powered by Atlas

Nuclear factor I A (NFIA) gene is located on the human chromosome 1p31.3.

Immunogen nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, beta Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are