-
HPA056496-100UL
Sigma-Aldrich
Anti-PABPC4 antibody produced in rabbit (C15-1462-367)
Price: $928.29List Price: $1,031.43Immunogen poly(A) binding protein, cytoplasmic 4 (inducible form) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA000164-100UL
Sigma-Aldrich
Anti-PABPC5 antibody produced in rabbit (C15-1444-880)
Price: $879.43List Price: $977.14Immunogen Polyadenylate-binding protein 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA000165-100UL
Sigma-Aldrich
Anti-PABPC5 antibody produced in rabbit (C15-1444-881)
Price: $879.43List Price: $977.14Immunogen Polyadenylate-binding protein 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA001632-100ULImmunogen phosphoprotein membrane anchor with glycosphingolipid microdomains 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by
-
HPA003473-100ULImmunogen G antigen family B member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA062248-100ULImmunogen P antigen family, member 3 (prostate associated) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
AV40651-100UL
Sigma-Aldrich
Anti-PAIP1 antibody produced in rabbit (C15-1341-263)
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the C terminal region of human PAIP1 Biochem/physiol Actions PAIP1 interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein -
HPA073653-100UL
Sigma-Aldrich
Anti-PAIP1 antibody produced in rabbit (C15-1466-417)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to poly(A) binding protein interacting protein 1 Sequence GTNGQVTRADILQVGLRELLNALFSNPMDDNLICAVKLLKLTGSVLEDAWKEKGKMDMEEIIQRIENVVLDANCSRDVKQMLLK Application All Prestige Antibodies Powered by Atlas -
HPA076187-100UL
Sigma-Aldrich
Anti-PAIP1 antibody produced in rabbit (C15-1466-847)
Price: $928.29List Price: $1,031.43Immunogen poly(A) binding protein interacting protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA028817-100ULImmunogen PAN3 poly(A) specific ribonuclease subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
HPA016930-100ULImmunogen Pannexin-1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
-
HPA073505-100ULImmunogen progestin and adipoQ receptor family member VI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive