Antibody Purification Kit Components

Immunogen plexin B3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen peptidase (mitochondrial processing) beta recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen peptidase (mitochondrial processing) beta Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to POC5 centriolar protein. Sequence KWEEYEELLHYAIVTPNIEPCASQSSHPKGELVPDVRISTIHDILHSQGNNSEVRETAIEVGKGCDFHISSHSKTDESSPVLSPRKPSHPVMD Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen POC5 centriolar protein homolog (Chlamydomonas) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Immunogen Recombinant protein corresponding to POC5 centriolar protein. Sequence YVPRVVTSAQQKAGRTITARITGRCDFASKNRISSSLAIMGVSPPMSSVVVEKHHPVTVQTIPQATAAKYPRTIHPESSTSASRSLGTRSAHTQSLTSVH Application All Prestige Antibodies Powered by Atlas Antibodies

Immunogen proopiomelanocortin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen proopiomelanocortin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to POP1 homolog, ribonuclease P/MRP subunit Sequence IPILLIQQPGKVTGEDRLGWGSGWDVLLPKGWGMAFWIPFIYRGVRVGGLKESAVHSQYKRSPNVPGDFPDCPAGMLFAEEQAKNLLEKYKRR Application All Prestige Antibodies Powered by Atlas

Immunogen processing of precursor 5, ribonuclease P/MRP subunit (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

P450 (cytochrome) oxidoreductase (POR, C&#947POR, P450R) is an FAD and FMN microsome membrane-bound enzyme required for electron transfer to several cytochrome P450 enzymes, heme oxygenase(s), cytochrome b(5) and squalene monooxygenases.

Cytochrome p450 oxidoreductase (POR) is a 78 kDa membrane-bound diflavin oxidoreductase, which is located on the cytoplasmic side of the endoplasmic reticulum and the outer membrane of the nuclear envelope. The gene is located on human chromosome