Antibody Purification Kit Components

PTPN22 (Protein tyrosine phosphatase, non-receptor type 22) is a non-receptor protein-tyrosine phosphatase. It is highly expressed in the T cells.

Immunogen protein tyrosine phosphatase, non-receptor type 22 (lymphoid) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen pituitary tumor-transforming 1 interacting protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to pentraxin 4 Sequence GGFDSSEAFVGSMSGLAIWDRALVPGEVANLAIGKEFPTGAILTLANAALAGGFVQGANCTCLERC Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Glutaminyl-peptide cyclotransferase (QPCT) is an enzyme localized in the mammalian brain. The gene encoding it is present on the chromosome 2p22.

R3HCC1 (R3H domain and coiled-coil containing 1) might be involved in nucleotide binding. The gene is mapped to human chromosome 8p.

R3HCC1 (R3H domain and coiled-coil containing 1) might be involved in nucleotide binding. The gene is mapped to human chromosome 8p.

Immunogen Growth inhibition and differentiation-related protein 88 (Putative mitochondrial space protein 32.1) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen R3H domain containing 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen R3H domain containing 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Anti-Rab 3 (Rabbit) antibody is suitable for use in Western Blots. Specific conditions for reactivity should be optimized by the end user.

Immunogen RAB11 family interacting protein 3 (class II) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a