-
Add to Cart The item has been addedHPA021676-100ULGuanine nucleotide binding protein (G protein), β polypeptide 2-like 1 (GNB2L1) is a stably expressed housekeeping gene localized in alveolar macrophage and neutrophils. The gene has been predicted to encode a protein RACK1 (Receptor for -
Add to Cart The item has been addedHPA052291-100ULImmunogen RAD50 homolog (S. cerevisiae) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA040365-100ULSigma-Aldrich
Anti-RAPGEF3 antibody produced in rabbit (C15-1456-157)
Price: $928.29List Price: $1,031.43Immunogen Rap guanine nucleotide exchange factor (GEF) 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA043518-100ULSigma-Aldrich
Anti-RAPGEF3 antibody produced in rabbit (C15-1457-729)
Price: $928.29List Price: $1,031.43Immunogen Rap guanine nucleotide exchange factor (GEF) 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA037982-100ULSigma-Aldrich
Anti-RAPGEF6 antibody produced in rabbit (C15-1455-007)
Price: $928.29List Price: $1,031.43Immunogen Rap guanine nucleotide exchange factor (GEF) 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA037983-100ULSigma-Aldrich
Anti-RAPGEF6 antibody produced in rabbit (C15-1455-008)
Price: $928.29List Price: $1,031.43Immunogen Rap guanine nucleotide exchange factor (GEF) 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA046759-100ULImmunogen RAS p21 protein activator 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA028242-100ULImmunogen RasGEF domain family, member 1C recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA077251-100ULImmunogen Recombinant protein corresponding to Ras interacting protein 1 Sequence CNDLELCDEAMALLDEVIMCTFQQSVYYLTKTLYSTLPALLDSNPFTAGAELPGPGAELGAMPPGLRP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by -
Add to Cart The item has been addedHPA040735-100ULThe Ras association domain family 1 A (RASSF1A) is a tumor suppressor gene that spans around 1859bp and has 6 exons (1α, 2αβ, 3, 4, 5, 6). The C terminal region of RASSF1A has a Salvador-RASSF1A-Hippo (SARAH) domain and ATM (ataxia -
Add to Cart The item has been addedHPA038469-100ULImmunogen Ras association (RalGDS/AF-6) domain family member 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA038834-100ULSigma-Aldrich
Anti-RASSF4 antibody produced in rabbit (C15-1455-464)
Price: $928.29List Price: $1,031.43Immunogen Ras association (RalGDS/AF-6) domain family member 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project
