-
HPA028151-100UL
Sigma-Aldrich
Anti-RTCA antibody produced in rabbit (C15-1451-725)
Price: $879.43List Price: $977.14Immunogen RNA terminal phosphate cyclase domain 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA000535-100UL
Sigma-Aldrich
Anti-RTCB antibody produced in rabbit (C15-1444-971)
Price: $879.43List Price: $977.14Immunogen RNA 2′,3′-cyclic phosphate and 5′-OH ligase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA001103-100UL
Sigma-Aldrich
Anti-RTCB antibody produced in rabbit (C15-1445-163)
Price: $879.43List Price: $977.14Immunogen UPF0027 protein C22orf28 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA036357-100ULImmunogen reticulon 4 interacting protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA044428-100ULImmunogen reticulon 4 receptor-like 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA050902-100ULImmunogen receptor (chemosensory) transporter protein 5 (putative) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
-
HPA023548-100UL
Sigma-Aldrich
Anti-RUNDC3A antibody produced in rabbit (C15-1450-431)
Price: $879.43List Price: $977.14The gene RUNDC3A (RUN domain containing 3A) encodes a protein that contains the RUN domain and is mapped to human chromosome 17q21.31. -
HPA070733-100UL
Sigma-Aldrich
Anti-RUNDC3A antibody produced in rabbit (C15-1465-897)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to RUN domain containing 3A Sequence TDEEERHSAESSTSEDNSPEHPYLPLVTDEDSWYSKWHKMEQKFRIVYAQK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
HPA056968-100UL
Sigma-Aldrich
Anti-RUNDC3B antibody produced in rabbit (C15-1462-512)
Price: $928.29List Price: $1,031.43Immunogen RUN domain containing 3B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA057155-100UL
Sigma-Aldrich
Anti-RUNDC3B antibody produced in rabbit (C15-1462-571)
Price: $928.29List Price: $1,031.43Immunogen RUN domain containing 3B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA075760-100UL
Sigma-Aldrich
ANTI-RUNDC3B ANTIBODY PRODUCED IN RABBIT (C15-1466-772)
Price: $977.14List Price: $1,085.71Immunogen RUN domain containing 3B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA028510-100UL
Sigma-Aldrich
Anti-RUSC1 antibody produced in rabbit (C15-1451-878)
Price: $879.43List Price: $977.14Immunogen RUN and SH3 domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are