-
HPA029922-100UL
Sigma-Aldrich
Anti-RUSC1 antibody produced in rabbit (C15-1452-468)
Price: $879.43List Price: $977.14Immunogen RUN and SH3 domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA029923-100UL
Sigma-Aldrich
Anti-RUSC1 antibody produced in rabbit (C15-1452-469)
Price: $879.43List Price: $977.14Immunogen RUN and SH3 domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA045503-100UL
Sigma-Aldrich
Anti-RYK antibody produced in rabbit (C15-1458-547)
Price: $928.29List Price: $1,031.43Immunogen receptor-like tyrosine kinase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA075430-100UL
Sigma-Aldrich
Anti-RYK antibody produced in rabbit (C15-1466-734)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to receptor-like tyrosine kinase Sequence LWELMTLGQTPYVDIDPFEMAAYLKDGYRIAQPINCPDELFAVMACCWALDPEERPKFQQLVQCLTEFHAALG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
HPA042677-100ULImmunogen SAC3 domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
-
HPA024634-100ULThe gene SAMD12 (sterile α motif domain containing 12) is mapped to human chromosome 8q24.12.
-
HPA058929-100ULImmunogen sterile alpha motif domain containing 13 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
HPA051916-100ULImmunogen sterile alpha motif domain containing 14 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a
-
HPA030673-100UL
Sigma-Aldrich
Anti-SAMD15 antibody produced in rabbit (C15-1452-789)
Price: $879.43List Price: $977.14Immunogen SAM domain-containing protein C14orf174 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA030677-100UL
Sigma-Aldrich
Anti-SAMD15 antibody produced in rabbit (C15-1452-791)
Price: $879.43List Price: $977.14Immunogen SAM domain-containing protein C14orf174 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA028992-100UL
Sigma-Aldrich
Anti-SAMD3 antibody produced in rabbit (C15-1452-085)
Price: $879.43List Price: $977.14Immunogen sterile alpha motif domain containing 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA028993-100UL
Sigma-Aldrich
Anti-SAMD3 antibody produced in rabbit (C15-1452-086)
Price: $879.43List Price: $977.14Immunogen sterile alpha motif domain containing 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a