Antibody Purification Kit Components

Immunogen Recombinant protein corresponding to SH3 domain binding kinase family member 3 Sequence EDTATALQRLVELTTSRVTPVRSLRDQYHLIRKLGSGSY Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen scavenger receptor class A, member 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen scavenger receptor class A, member 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

The gene SCARA5 (scavenger receptor class A member 5) is mapped to human chromosome 8p21. It belongs to the SCARA family of proteins.

Immunogen scavenger receptor class B, member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to sodium voltage-gated channel beta subunit 3 Sequence RLQWNGSKDLQDVSITVLNVTLNDSGLYTCNVSREFEFEAHRPFVKTTRLIPLRVTEEAGEDFT Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Voltage-gated sodium channels perform critical roles for electrical signaling in the nervous ssystem by generating action potentials in axons and dndrites. At least 10 genes encode sodium channels in mammals, but specific physiological roles that

Immunogen Syndecan-1 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen syndecan 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

SDC3 (syndecan 3) is a membrane-bound, cell-surface heparan sulfate proteoglycan involved in various cellular activities. It exists as four types namely syndecan 1-4.

Immunogen syndecan 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Syndecan 4 (SDC4) is a cell surface proteoglycan which binds heparan sulphate. It has membrane-spanning domains, intracellular domains and structurally distinct extracellular domains.