Antibody Purification Kit Components

Immunogen Sodium/bile acid cotransporter 5 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

SLC10A6 (Solute carrier family 10 member 6) is a sodium-dependent organic anion transporter belonging to the solute carrier family. It is highly expressed in testis, placenta, and pancreas.

Immunogen solute carrier family 10 (sodium/bile acid cotransporter family), member 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen solute carrier family 10, member 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen solute carrier family 12 (sodium/chloride transporters), member 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen solute carrier family 12 (potassium/chloride transporters), member 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen solute carrier family 12 (potassium/chloride transporter), member 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen solute carrier family 12 (potassium/chloride transporters), member 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen Recombinant protein corresponding to solute carrier family 12 member 9 Sequence AWHSARLRIFLCLGPREAPGAAEGRLRALLSQLRIRAEVQEVVWGEGAGAGEPEAEEEGDFVNSGRGDAEAEALAR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen Synthetic peptide directed towards the middle region of human SLC13A3 Biochem/physiol Actions Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on

Immunogen Recombinant protein corresponding to solute carrier family 13 member 3 Sequence DFKAPNTETEPLLTWKKAQETVPWNIILLLGGGFAMAKGCEESGLSVWIGGQLHPLENVP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen Solute carrier family 13 member 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are