Antibody Purification Kit Components

Immunogen solute carrier family 26, member 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Synthetic peptide directed towards the middle region of human SLC26A5 Application Anti-SLC26A5 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5&#956g/ml and for immunohistochemistry of

Immunogen solute carrier family 26, member 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen solute carrier family 26, member 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen solute carrier family 26, member 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to solute carrier family 27 member 1 Sequence QREGFDPRQTSDRLFFLDLKQGHYLPLNEAVYTRICSGAF Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Solute carrier family 27 member 2 (SLC27A2) is expressed in microsomes and peroxisomes. The gene encoding it is localized on human chromosome 15q21.

SLC27A3 (Solute carrier family 27 (fatty acid transporter), member 3) is a plasma membrane located, fatty acid transport protein. It is a novel member of fatty acid transport protein (FATP) family.

Immunogen solute carrier family 27 (fatty acid transporter), member 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

SLC27A4 (solute carrier family 27 (fatty acid transporter), member 4) gene is localized to human chromosome 9q33.3-34.

SLC27A5 is a fatty acid transport protein that regulates metabolism of bile acids in the liver. This protein functions as a ligase and reconjugates bile acids for hepatic recycling .

SLC27A6 (solute carrier family 27, member 6) is a fatty acid-binding membrane protein. It is predominantly expressed in heart muscle.