Antibody Purification Kit Components

Immunogen solute carrier family 39, member 11 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen solute carrier family 39 (zinc transporter), member 13 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen Zinc transporter ZIP14 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen solute carrier family 39 member 14 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen solute carrier family 39 (zinc transporter), member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen solute carrier family 39 member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen Synthetic peptide directed towards the N terminal region of human SLC39A5 Application Anti-SLC39A5 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0&#956g/ml and for immunohistochemistry of

SLC41A1 (solute carrier family 41, member 1) is a cytoplasmic integral membrane protein, and has either ten or eleven transmembrane domains. The N-terminal faces the cytoplasm.

Immunogen solute carrier family 41, member 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Solute carrier family 43 member 3 (SLC43A3) belongs to an amino acid transporter family. It is expressed in fetal liver, kidney, placenta and lung.

Immunogen Recombinant protein corresponding to solute carrier family 43 member 3 Sequence FKNEDYFKDLCGPDAGPIGNATGQADCKAQDERFS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen solute carrier family 44 (choline transporter), member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most