Antibody Purification Kit Components

Immunogen solute carrier family 6 (neurotransmitter transporter, GABA), member 11 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen solute carrier family 6 (neurotransmitter transporter, betaine/GABA), member 12 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

SLC6A14 (solute carrier family 6 member 14) is the 14th member of the Na + and Cl - dependent solute transport protein family. It acts as a dipolar and cationic amino acid transporter, and is a &#946-alanine carrier.

SLC6A15 (solute carrier family 6, member 15) gene is highly expressed in human brains, where it is especially expressed in hippocampus. Its expression is restricted to neurons.

Immunogen solute carrier family 6, member 16 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen solute carrier family 6 member 17 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen Orphan sodium- and chloride-dependent neurotransmitter transporter NTT4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen Synthetic peptide directed towards the middle region of human SLC6A18 Application Anti-SLC6A18 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25&#956g/ml and for immunohistochemistry of

Immunogen Sodium- and chloride-dependent transporter XTRP2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Immunogen solute carrier family 6 (neutral amino acid transporter), member 19 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen solute carrier family 6 (neutral amino acid transporter), member 19 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen Recombinant protein corresponding to solute carrier family 6 member 3 Sequence SKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDRET Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the