-
Add to Cart The item has been addedHPA026744-100ULSigma-Aldrich
Anti-SPACA1 antibody produced in rabbit (C15-1451-183)
Price: $879.43List Price: $977.14Sperm acrosome associated 1(spaca1) belongs to the family of globozoospermia-related genes. This protein is present in the equatorial segment of mammalian spermatozoa. -
Add to Cart The item has been addedHPA043297-100ULSigma-Aldrich
Anti-SPACA1 antibody produced in rabbit (C15-1457-621)
Price: $928.29List Price: $1,031.43Immunogen sperm acrosome associated 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA023633-100ULImmunogen Sperm acrosome membrane-associated protein 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA041927-100ULSigma-Aldrich
Anti-SPACA4 antibody produced in rabbit (C15-1456-967)
Price: $928.29List Price: $1,031.43Immunogen sperm acrosome associated 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA061302-100ULSigma-Aldrich
Anti-SPACA4 antibody produced in rabbit (C15-1463-745)
Price: $928.29List Price: $1,031.43Immunogen sperm acrosome associated 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA023842-100ULSigma-Aldrich
Anti-SPAG11B antibody produced in rabbit (C15-1450-521)
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to sperm associated antigen 11B Sequence DVPLGIRNTICRMQQGICRLFFCHSGEKKRDICSDPWNRCCVSNTDEEGKEKPEMDGRSGI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the -
Add to Cart The item has been addedHPA057479-100ULSigma-Aldrich
ANTI-SPAG11B ANTIBODY PRODUCED IN RABBIT (C15-1462-667)
Price: $977.14List Price: $1,085.71Immunogen sperm associated antigen 11B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA038440-100ULSperm associated antigen 6 (SPAG6) is a novel cancer-testis antigen, encoded by the gene mapped to human chromosome 10p11.2–p12. -
Add to Cart The item has been addedHPA017984-100ULSperm adhesion molecule 1 (SPAM1) belongs to the hyaluronidase family and the gene encoding it is localized on human chromosome 7q31. Immunogen Hyaluronidase PH-20 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige -
Add to Cart The item has been addedHPA047144-100ULImmunogen SPC25, NDC80 kinetochore complex component, homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
Add to Cart The item has been addedHPA021421-100ULSigma-Aldrich
Anti-SPECC1 antibody produced in rabbit (C15-1449-859)
Price: $879.43List Price: $977.14The gene SPECC1 (sperm antigen with calponin homology and coiled-coil domains 1) is mapped to human chromosome 17p11.2. -
Add to Cart The item has been addedHPA021430-100ULSigma-Aldrich
Anti-SPECC1 antibody produced in rabbit (C15-1449-862)
Price: $879.43List Price: $977.14The gene SPECC1 (sperm antigen with calponin homology and coiled-coil domains 1) is mapped to human chromosome 17p11.2.
