Antibody Purification Kit Components

Immunogen transforming acidic coiled-coil containing protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Transforming acidic coiled-coil-containing protein 3 recombinant protein epitope signature tag (PrEST) Application Anti-TACC3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA)

Transforming acidic coiled-coil-containing protein 3 is encoded by TACC3 gene in humans and belonging to the human transforming acidic coiled-coil (TACC) family of centrosomal adaptor proteins. It is also known as ERIC1 and ERIC-1.

TACR3 (tachykinin receptor 3), also called neurokinin 3 receptor (NK3R), is a member of the rhodopsin superfamily G-protein coupled receptor. This receptor is composed of an N-terminal, seven transmembrane domains connected by three intracellular

Immunogen TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Synthetic peptide directed towards the N terminal region of human TAF6 Biochem/physiol Actions TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs.

Immunogen TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen transgelin 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Recombinant protein corresponding to TAL bHLH transcription factor 1, erythroid differentiation factor Sequence PDDLLQDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADG Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen transmembrane and coiled-coil domains 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Tapasin precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the