-
HPA001173-100ULImmunogen TBC1 domain family member 22A recombinant protein epitope signature tag (PrEST) Application Anti-TBC1D22A antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each
-
HPA027908-100UL
Sigma-Aldrich
Anti-TBC1D22B antibody produced in rabbit (C15-1451-657)
Price: $879.43List Price: $977.14Immunogen TBC1 domain family, member 22B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA027909-100UL
Sigma-Aldrich
Anti-TBC1D22B antibody produced in rabbit (C15-1451-658)
Price: $879.43List Price: $977.14Immunogen TBC1 domain family, member 22B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA027910-100UL
Sigma-Aldrich
Anti-TBC1D22B antibody produced in rabbit (C15-1451-659)
Price: $879.43List Price: $977.14Immunogen TBC1 domain family, member 22B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA038151-100UL
Sigma-Aldrich
Anti-TBC1D23 antibody produced in rabbit (C15-1455-099)
Price: $928.29List Price: $1,031.43Immunogen TBC1 domain family, member 23 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA038152-100UL
Sigma-Aldrich
Anti-TBC1D23 antibody produced in rabbit (C15-1455-100)
Price: $928.29List Price: $1,031.43Immunogen TBC1 domain family, member 23 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA044712-100UL
Sigma-Aldrich
Anti-TBC1D24 antibody produced in rabbit (C15-1458-252)
Price: $928.29List Price: $1,031.43Immunogen TBC1 domain family, member 24 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA068080-100UL
Sigma-Aldrich
Anti-TBC1D24 antibody produced in rabbit (C15-1465-429)
Price: $928.29List Price: $1,031.43Immunogen TBC1 domain family, member 24 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA029197-100ULImmunogen TBC1 domain family, member 25 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA050460-100ULImmunogen TBC1 domain family member 26 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA059178-100ULImmunogen TBC1 domain family, member 29 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in
-
HPA041833-100UL
Sigma-Aldrich
Anti-TBC1D2B antibody produced in rabbit (C15-1456-911)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to TBC1 domain family member 2B Sequence YWLQELQQKRWEYCNSLDMVKWDSRTSPTPGDFPKGLVARDNTDLIYPHPNASAEKARNVLAVETVPGELVGEQAANQPAPGHPNSINFYSLKQWGNE Application All Prestige Antibodies Powered by Atlas Antibodies