Antibody Purification Kit Components

Immunogen T-box 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human

TBX15 codes for T-box transcription factor that regulates embryonic development. TBX15 mutations have been linked to Cousin syndrome.

Immunogen T-box 15 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

TBX19 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes.

Rabbit polyclonal anti-TBX19 antibody reacts with canine, human, mouse, and bovine T-box 19 transcription factors. T-box 19 (TBX19) is a transcription factor that binds the DNA sequence called T-box found in the promoters of certain genes.

Immunogen Recombinant protein corresponding to T-box 19 Sequence EVHASTPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVSTWTAVASHPFAGWGGPGAGGHHSPSSLDG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen Synthetic peptide directed towards the N terminal region of human TBX20 Biochem/physiol Actions TBX20 is a member of the T-box transcription factor family expressed in the developing heart, eye, ventral neural tube, and limbs, indicating

Rabbit polyclonal anti-TBX21 (AB1) antibody reacts with human, bovine, canine, and mouse T-box transcription factor 21 transcription factors. T-box genes encode transcription factors that regulate developmental processes.

Rabbit polyclonal anti-TBX21 antibody reacts with canine, bovine, pig, human, mouse, and rat T-box transcription factor 21 transcription factors. T-box genes encode transcription factors that regulate developmental processes.

Immunogen T-box 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human

Immunogen Recombinant protein corresponding to T-box 6 Sequence HKYQPRIHLVRAAQLCSQHWGGMASFRFPETTFIS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

TCF-21 is a mesoderm specific basic-helix-loop-helix transcription factor. It forms a dimer with TCF-3 and binds to Ebox motifs to initiate transcription.