Antibody Purification Kit Components

FAM21C, also known as WASH complex subunit FAM21C, is a part of the a 500 kDa core complex that allows the Wiskott-Aldrich syndrome protein (WASH) function. FAM21C can be found in the membranes of early endosomes.

Aquaporins are transmembrane proteins composed of 6 &#945 helices that regulate the flow of water across the membrane. AQP1 is highly expressed on the apical membrane of kidneys.

Aquaporins are transmembrane proteins composed of 6 &#945 helices that regulate the flow of water across the membrane. AQP1 is highly expressed on the apical membrane of kidneys.

Aquaporin 2 (AQP2) exists as a tetramer with C terminus showing multiple conformations and binds two cadmium ions. AQP2 gene is mapped to human chromosome 12q13.

Aquaporin 2 (AQP2) exists as a tetramer with C terminus showing multiple conformations and binds two cadmium ions. AQP2 gene is mapped to human chromosome 12q13.

Immunogen WD repeat and coiled coil containing recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen WD repeat-containing protein 13 recombinant protein epitope signature tag (PrEST) Sequence GHRRSVSRGSYQLQAQMNRAVYEDRPPGSVVPTSAAEASRAMAGDTSLSENYAFAGMYHVFDQHVDEAVPRVRFANDDRHRLACCSLDGSISLCQLVPAPPTVLRVLR Application All Prestige Antibodies

Immunogen WD repeat domain 19 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen WD repeat domain 19 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen WD repeat domain 24 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen WD repeat protein 25 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen WD repeat domain 26 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the