-
HPA040005-100UL
Sigma-Aldrich
Anti-WDR66 antibody produced in rabbit (C15-1456-016)
Price: $928.29List Price: $1,031.43Immunogen WD repeat domain 66 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA028177-100UL
Sigma-Aldrich
Anti-WDTC1 antibody produced in rabbit (C15-1451-734)
Price: $879.43List Price: $977.14Immunogen WD and tetratricopeptide repeats 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA028180-100UL
Sigma-Aldrich
Anti-WDTC1 antibody produced in rabbit (C15-1451-736)
Price: $879.43List Price: $977.14Immunogen WD and tetratricopeptide repeats 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA028182-100UL
Sigma-Aldrich
Anti-WDTC1 antibody produced in rabbit (C15-1451-737)
Price: $879.43List Price: $977.14Immunogen WD and tetratricopeptide repeats 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA031411-100ULImmunogen WAP four-disulfide core domain 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA007121-100ULImmunogen WNT1-inducible-signaling pathway protein 1 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project
-
HPA062438-100UL
Sigma-Aldrich
Anti-WISP3 antibody produced in rabbit (C15-1464-078)
Price: $928.29List Price: $1,031.43Immunogen WNT1 inducible signaling pathway protein 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA078340-100UL
Sigma-Aldrich
Anti-WISP3 antibody produced in rabbit (C15-1467-160)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to WNT1 inducible signaling pathway protein 3 Sequence GTGPLDTTPEGRPGEVSDAPQRKQFCHWPCKCPQQKPRCPPGV Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
HPA069520-100ULImmunogen wntless Wnt ligand secretion mediator Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
HPA055048-100UL
Sigma-Aldrich
Anti-WNT10B antibody produced in rabbit (C15-1461-875)
Price: $928.29List Price: $1,031.43Immunogen wingless-type MMTV integration site family, member 10B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
HPA062539-100UL
Sigma-Aldrich
Anti-WNT10B antibody produced in rabbit (C15-1464-114)
Price: $928.29List Price: $1,031.43Immunogen wingless-type MMTV integration site family, member 10B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA026893-100ULImmunogen WD repeat domain 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by