Antibody Purification Kit Components

Immunogen laminin, alpha 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen laminin, alpha 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen laminin, alpha 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen Laminin subunit alpha 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Mouse monoclonal anti-Na + /K + ATPase (&#9453 subunit) antibody reacts specifically with Na + /K + ATPase &#9453 subunit. By immunoblotting, the product reacts with human, monkey, sheep, canine, rabbit, guinea pig and rat tissues in which the

Monoclonal Anti-N-CAM (mouse IgG1 isotype) is derived from the hybridoma produced by the fusion of mouse myeloma cells and splenocytes from an immunized mouse. Neural cell adhesion molecule (N-CAM), the best characterized CAM, exists in adult brain.

Monoclonal Anti-N-CAM (mouse IgG1 isotype) is derived from the hybridoma produced by the fusion of mouse myeloma cells and splenocytes from an immunized mouse. Neural cell adhesion molecule (N-CAM), the best characterized CAM, exists in adult brain.

Immunogen Recombinant protein corresponding to paired box 6 Sequence VSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPVPSQTSSYSCMLPTSPSVNGRSYDTYTPPHMQTHMNSQPMGTSGTTSTGLISPGVSVPVQVPGSEPDMSQYW Application All Prestige Antibodies Powered by Atlas Antibodies

The secretory component is a single chain glycoprotein that may occur freely or as component of the secretory immunoglobulin A (SIgA). IgA regulates the physiological balance between commensal intestinal bacteria and the defenses of the host immune

The secretory component is a single chain glycoprotein that may occur freely or as component of the secretory immunoglobulin A (SIgA). IgA regulates the physiological balance between commensal intestinal bacteria and the defenses of the host immune

Immunogen Recombinant protein corresponding to Tubulin beta 3 class iii Sequence YEDDEEESEAQGPK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen Recombinant protein corresponding to Tubulin beta 3 class iii Sequence YEDDEEESEAQGPK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,