Antibody Purification Kit Components

Immunogen Recombinant protein corresponding to activin A receptor type 1 Sequence EKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLE Application All Prestige Antibodies Powered by Atlas Antibodies

Immunogen activin A receptor, type IB Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

ADAMTS-3 belongs to the ADAM (A Disintegrin And Metalloproteinase) family and has thrombospondin (TS) repeats. Studies have suggested that ADAMTS-3 is preferably expressed in the cartilages and has procollagen II N-propeptidase functions.

The gene ADCK5 (aarF domain containing kinase 5) is mapped to human chromosome 8q24.3.

The gene ADCK5 (aarF domain containing kinase 5) is mapped to human chromosome 8q24.3.

Immunogen Recombinant protein corresponding to adrenoceptor beta 3 Sequence TCAPPEGVPACGRRPARLLPLREHR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen aldo-keto reductase family 1, member C1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen aldo-keto reductase family 1, member C4 (chlordecone reductase 3-alpha hydroxysteroid dehydrogenase, type I dihydrodiol dehydrogenase 4) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by

Akt (protein kinase B), a serine/threonine kinase, has emerged as a critical enzyme in signal transduction pathways involved in cell proliferation, apoptosis, angiogenesis, and diabetes. In mammals three isoforms of Akt (&#945, &#946, &#947 or

Immunogen APC membrane recruitment protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen APC membrane recruitment protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen antagonist of mitotic exit network 1 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)