Antibody Purification Kit Components

CD300C (CD300c molecule) is a membrane receptor belonging to the IgV-like glycoprotein family called CD300. This family includes activating members namely, CD300b, CD300c, CD300d and CD300e, and inhibitory members namely, CD300a and CD300f.

Immunogen CD300c molecule Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen CMRF35-like molecule 2 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen CD300 molecule like family member b Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen CD300 molecule-like family member f recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Myeloid cell surface antigen CD33 (cluster of differentiation 33), also known as SIGLEC3 (sialic acid binding Ig-like lectins) and GP67, belongs to the CD33-related SIGLEC gene family. It is a type 1 transmembrane protein and has two

Immunogen CD34 molecule Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

CD34 (cluster of differentiation 34) molecule, a cell surface antigen, is expressed in hematopoietic stem cells and vascular endothelium. This gene is 26&#160kb in length and contain 8 exons.

CD36 is a glycoprotein that functions as a receptor for thrombospondin in platelets. Studies have reported that TLR4 signaling inhibited the expression of CD36 and subsequently slowed hematoma absorption.

CD36 is a major platelet membrane glycoprotein IV. Immunogen Platelet glycoprotein 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen Recombinant protein corresponding to CD36 molecule Sequence LLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen ADP-ribosyl cyclase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by