-
HPA026587-100ULImmunogen Cell division cycle-associated protein 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a
-
HPA023691-100UL
Sigma-Aldrich
Anti-CDCA5 antibody produced in rabbit (C15-1450-486)
Price: $879.43List Price: $977.14Immunogen Sororin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA076007-100UL
Sigma-Aldrich
ANTI-CDCA5 ANTIBODY PRODUCED IN RABBIT (C15-1466-811)
Price: $977.14List Price: $1,085.71Immunogen cell division cycle associated 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA056332-100ULImmunogen cadherin 19, type 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by
-
HPA015722-100UL
Sigma-Aldrich
Anti-CDH26 antibody produced in rabbit (C15-1448-433)
Price: $879.43List Price: $977.14Immunogen Cadherin-like protein 26 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA047578-100UL
Sigma-Aldrich
Anti-CDH26 antibody produced in rabbit (C15-1459-276)
Price: $928.29List Price: $1,031.43Immunogen cadherin 26 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
HPA011218-100ULCDHR3 (cadherin-related family member 3) has a high level of expression in the epithelium of airway. Immunogen Cadherin-like protein 28 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas
-
HPA049352-100ULImmunogen chromosome 16 open reading frame 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA007451-100UL
Sigma-Aldrich
Anti-CDK10 antibody produced in rabbit (C15-1446-895)
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to cyclin dependent kinase 10 Sequence RMDKEKDGIPISSLREITLLLRLRHPNIVELKEVVVGNHLESIFLVMGYCEQDLASLLENMPTPFSEAQVKCIVLQVLRGLQYLHRNFIIHRDLKVSNLLMTDKGCVKTADFGLARAYGVPVK Application All Prestige Antibodies -
HPA059634-100UL
Sigma-Aldrich
Anti-CDK10 antibody produced in rabbit (C15-1463-337)
Price: $928.29List Price: $1,031.43Immunogen cyclin-dependent kinase 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA067060-100UL
Sigma-Aldrich
Anti-CDK10 antibody produced in rabbit (C15-1465-210)
Price: $928.29List Price: $1,031.43Immunogen cyclin-dependent kinase 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA045429-100ULImmunogen cyclin-dependent kinase 18 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are