-
Add to Cart The item has been addedHPA077906-100ULSigma-Aldrich
Anti-CNEP1R1 antibody produced in rabbit (C15-1467-110)
Price: $928.29List Price: $1,031.43Immunogen CTD nuclear envelope phosphatase 1 regulatory subunit 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA049073-100ULSigma-Aldrich
Anti-CNFN antibody produced in rabbit (C15-1459-809)
Price: $928.29List Price: $1,031.43Immunogen cornifelin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA053997-100ULSigma-Aldrich
Anti-CNFN antibody produced in rabbit (C15-1461-525)
Price: $928.29List Price: $1,031.43Immunogen cornifelin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA049378-100ULImmunogen Recombinant protein corresponding to cyclic nucleotide gated channel alpha 3 Sequence FLLRRWAARHVHHQDQGPDSFPDRFRGAELKEVSSQESNAQANVGSQEPADRGRSAWPLAKCNTNTSNNTEEEK Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
Add to Cart The item has been addedHPA002544-100ULCornichon (CNIH) is expressed in a wide range of human tissues with different expression levels. It is found abundantly in the heart, liver, skeletal muscle, pancreas, adrenal medulla and cortex, thyroid, testis, spleen, appendix, peripheral blood -
Add to Cart The item has been addedHPA044268-100ULImmunogen cornichon homolog 4 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA049651-100ULImmunogen CNKSR family member 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA051237-100ULImmunogen calponin 3, acidic Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA017732-100ULAncient conserved domain-containing protein 4 (CNNM4) contains a highly conserved domain which is evolutionarily conserved from bacteria to mammals. In total, it has four transmembrane domains. -
Add to Cart The item has been addedC9743-100UGImmunogen synthetic peptide corresponding to residues 122-136 of human CNPase. The sequence is 93% identical in mouse and rat. -
Add to Cart The item has been addedHPA007225-100ULSigma-Aldrich
Anti-CNST antibody produced in rabbit (C15-1446-835)
Price: $879.43List Price: $977.14Immunogen Uncharacterized protein C1orf71 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA007226-100ULSigma-Aldrich
Anti-CNST antibody produced in rabbit (C15-1446-836)
Price: $879.43List Price: $977.14Immunogen consortin, connexin sorting protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization
