-
Add to Cart The item has been addedHPA019654-100ULCNTF (Ciliary neurotrophic factor) is a neural cytokine belonging to the hematopoietic cytokine subfamily. It is predominantly expressed in the anterior nuclei of the thalamus. -
Add to Cart The item has been addedHPA007201-100ULSigma-Aldrich
Anti-CNTLN antibody produced in rabbit (C15-1446-830)
Price: $879.43List Price: $977.14Immunogen centlein, centrosomal protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA036728-100ULSigma-Aldrich
Anti-CNTLN antibody produced in rabbit (C15-1454-510)
Price: $928.29List Price: $1,031.43Immunogen centlein, centrosomal protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA036729-100ULSigma-Aldrich
Anti-CNTLN antibody produced in rabbit (C15-1454-511)
Price: $928.29List Price: $1,031.43Immunogen centlein, centrosomal protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA070467-100ULImmunogen Recombinant protein corresponding to contactin 1 Sequence TNGNLYIANVEASDKGNYSCFVSSPSITKSVFSKFIPLIPIPERTTKPYPADIVVQFKDVYALMGQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
Add to Cart The item has been addedHPA003341-100ULImmunogen Contactin-3 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA016645-100ULImmunogen Contactin-6 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA047731-100ULImmunogen contactin associated protein-like 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA029224-100ULImmunogen component of oligomeric golgi complex 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA040353-100ULSigma-Aldrich
Anti-COG3 antibody produced in rabbit (C15-1456-152)
Price: $928.29List Price: $1,031.43Immunogen component of oligomeric golgi complex 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA054470-100ULSigma-Aldrich
Anti-COG3 antibody produced in rabbit (C15-1461-689)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to component of oligomeric golgi complex 3 Sequence DGQLFLIKHLLILREQIAPFHTEFTIKEISLDLKKTRDAAFKILNPMTVPRFFRLNSNNALIEFLLEGTPEIREHYLDSKKDVDRHLKSACEQFIQQQT Application All Prestige Antibodies Powered by Atlas -
Add to Cart The item has been addedAV52418-100ULImmunogen Synthetic peptide directed towards the N terminal region of human COL4A3BP Biochem/physiol Actions COL4A3BP is a kinase that specifically phosphorylates the N-terminal region of the non-collagenous domain of the alpha 3 chain of type IV
