Antibody Purification Kit Components

Immunogen Recombinant protein corresponding to carnitine palmitoyltransferase 1C Sequence AQVRTSLKTQAAEALEAVEGAAFFVSLDAEPAGLTREDPAASLDAYAHALLAG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen complement component (3b/4b) receptor 1 (Knops blood group) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen complement component (3b/4b) receptor 1 (Knops blood group) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

CR1 (complement receptor type 1) is a member of complement inhibitors family. It is also known as CD35.

Immunogen crumbs family member 1, photoreceptor morphogenesis associated Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen crumbs family member 1, photoreceptor morphogenesis associated Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

CRB3 is the mammalian homologue of the Drosophila melanogaster Crumbs protein and regulates the polarity and morphogenesis of mammalian epithelial tissues. CRB3 is also expressed in human skeletal muscle cells .

Cyclic AMP-responsive element-binding protein (CREB) is a beta ZIP transcription factor that activates target genes through cAMP response elements. CREB is able to mediate signals from numerous physiological stimuli, resulting in regulation of a

CREB1 is a leucine zipper transcription factor that interacts with cAMP-responsive element. Rabbit Anti-CREB1 antibody recognizes human, mouse, rat, bovine, and canine CREB1.

The gene CREB1 (cyclic AMP-responsive element-binding protein 1) is mapped to human chromosome 2q34. It is a member of the leucine zipper family of DNA-binding proteins.

Immunogen cAMP-responsive element-binding protein 3-like protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen cAMP responsive element binding protein 3-like 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as