-
Add to Cart The item has been addedHPA003448-100ULImmunogen Recombinant protein corresponding to crystallin beta B1 Sequence TTVPITSAKAAELPPGNYRLVVFELENFQGRRAEFSGECSNLADRGFDRVRSIIVSAGPWVAFEQSNFRGEMFILEKGEYPRWNTWSSSYRSDRLMSFRPIKMDAQE Application All Prestige Antibodies Powered by Atlas Antibodies -
Add to Cart The item has been addedHPA075635-100ULImmunogen crystallin beta-gamma domain containing 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA043386-100ULImmunogen crystallin gamma A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA050788-100ULImmunogen crystallin, gamma N recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA035103-100ULSigma-Aldrich
Anti-CRYGS antibody produced in rabbit (C15-1453-692)
Price: $928.29List Price: $1,031.43Immunogen crystallin, gamma S recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA063539-100ULSigma-Aldrich
ANTI-CRYGS ANTIBODY PRODUCED IN RABBIT (C15-1464-388)
Price: $977.14List Price: $1,085.71Immunogen crystallin gamma S Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA040403-100ULImmunogen crystallin, lambda 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA019120-100ULSigma-Aldrich
Anti-CRYZL1 antibody produced in rabbit (C15-1449-220)
Price: $879.43List Price: $977.14The gene CRYZL1 (crystalline ζ like protein 1) is mapped to human chromosome 21q22.1. -
Add to Cart The item has been addedHPA029399-100ULSigma-Aldrich
Anti-CRYZL1 antibody produced in rabbit (C15-1452-247)
Price: $879.43List Price: $977.14Immunogen crystallin, zeta (quinone reductase)-like 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA078264-100ULImmunogen Recombinant protein corresponding to chondrosarcoma associated gene 1 Sequence PLSNNHPSTPKRRGRGKHPLIPGPEALSKF Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA018846-100ULSigma-Aldrich
Anti-CSDE1 antibody produced in rabbit (C15-1449-105)
Price: $879.43List Price: $977.14The gene CSDE1 (cold shock domain-containing protein E1) is mapped to human chromosome 1p. CSDE1 is also called as UNR (N-ras upstream gene). -
Add to Cart The item has been addedHPA052221-100ULSigma-Aldrich
Anti-CSDE1 antibody produced in rabbit (C15-1460-948)
Price: $928.29List Price: $1,031.43Immunogen cold shock domain containing E1, RNA-binding Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
