Antibody Purification Kit Components

Immunogen catenin beta like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen catenin, beta like 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen Synthetic peptide directed towards the N terminal region of human CTRL Sequence Synthetic peptide located within the following region: SQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNS Physical form Purified antibody supplied in 1x PBS

Immunogen chymotrypsin-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen chymotrypsin-like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Complement C1q tumor necrosis factor-related protein 3 (CTRP3 or C1QTNF3), also known as Collagenous repeat-containing sequence 26 kDa protein, contains one C1q domain and one collagen-like domain, and may play an important role in skeletal

Immunogen cathepsin Z Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen cathepsin Z Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

CTXN1 (Cortexin-1) is a neuron specific integral membrane protein consisting of a membrane-spanning region. It is expressed in the cortex portion of adult brain and fetal brain.

Immunogen p53-associated parkin-like cytoplasmic protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen cullin 9 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human

CWC27 spliceosome-associated protein homolog (CWC27) is part of the spliceosome complex. Immunogen Peptidyl-prolyl cis-trans isomerase SDCCAG10 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas