-
Add to Cart The item has been addedHPA012567-100ULImmunogen Cytochrome P450 26B1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA062460-100ULSigma-Aldrich
Anti-CYP27C1 antibody produced in rabbit (C15-1464-085)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to cytochrome P450 family 27 subfamily C member 1 Sequence TTSFTLSWTVYLLARHPEVQQTVYREIVKNLGERHVPTAADVPKVPLVRALLK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated -
Add to Cart The item has been addedHPA068731-100ULSigma-Aldrich
Anti-CYP27C1 antibody produced in rabbit (C15-1465-529)
Price: $928.29List Price: $1,031.43Immunogen cytochrome P450, family 27, subfamily C, polypeptide 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA066463-100ULImmunogen cytochrome P450, family 3, subfamily A, polypeptide 43 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA029853-100ULCYR61 (cysteine-rich angiogenic inducer 61) is an extracellular and heparin-binding protein . It is also known as CCN1 (CCN family member 1) and IGFBP10 (angiogenic factor). -
Add to Cart The item has been addedHPA028882-100ULImmunogen defender against cell death 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA036862-100ULImmunogen DALR anticodon binding domain containing 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA051452-100ULSigma-Aldrich
Anti-DBN1 antibody produced in rabbit (C15-1460-667)
Price: $928.29List Price: $1,031.43Immunogen drebrin 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA056940-100ULSigma-Aldrich
Anti-DBN1 antibody produced in rabbit (C15-1462-498)
Price: $928.29List Price: $1,031.43Immunogen drebrin 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA035365-100ULImmunogen debranching enzyme homolog 1 (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA055376-100ULSigma-Aldrich
Anti-DCC antibody produced in rabbit (C15-1461-994)
Price: $928.29List Price: $1,031.43Immunogen DCC netrin 1 receptor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA069552-100ULSigma-Aldrich
Anti-DCC antibody produced in rabbit (C15-1465-701)
Price: $928.29List Price: $1,031.43Immunogen DCC netrin 1 receptor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
