Antibody Purification Kit Components

Immunogen Probable ATP-dependent RNA helicase DDX6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen DEAD (Asp-Glu-Ala-Asp) box polypeptide 60-like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen DEAD (Asp-Glu-Ala-Asp) box polypeptide 60-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen defensin, beta 106B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen defensin, beta 108B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

DENR (Density-regulated protein) is a cell density regulated protein. It is highly expressed in skeletal and cardiac muscle.

Immunogen DEP domain containing 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen Recombinant protein corresponding to 24-dehydrocholesterol reductase Sequence SKLNSIGNYYKPWFFKHVENYLKTNREGLEYIPLRHYYHRHTRSIFWELQDIIPFGNNPIFRYLFGWMVPPKISLLKLTQGETLRKLYEQHHVVQDMLVPMKCLQQALHTFQNDIHVYPIWLCPFILPSQPGLVHPKG Application All

Immunogen 24-dehydrocholesterol reductase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

DIAPH1 (Diaphanous-related formin 1) is a diaphanous protein belonging to the family of formin-related protein. Immunogen Protein diaphanous homolog 1 recombinant protein epitope signature tag (PrEST) Application Anti-DIAPH1 antibody produced in

Immunogen diaphanous-related formin 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

DIRAS family GTPase 3 (DIRAS3), also known as aplasia Ras homologue member I (ARHI), is an imprinted tumor suppressor gene. It is expressed in epithelial cells.