Antibody Purification Kit Components

Immunogen DnaJ (Hsp40) homolog, subfamily C, member 27 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen DnaJ (Hsp40) homolog, subfamily C, member 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen DnaJ (Hsp40) homolog, subfamily C, member 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

DNAJC4 (DnaJ (Hsp40) homolog, subfamily C, member 4) is a J domain containing protein belonging to the DnaJ family of proteins. It consists of a membrane-spanning region adjacent to their J domain, gly/phe-rich domain and a loosely conserved

Immunogen DnaJ heat shock protein family (Hsp40) member C5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

DnaJ homolog subfamily C member 5 (DNAJC5) contains an N-terminal J-domain, an adjacent linker region, a cysteine rich domain and a variable C terminus. DNAJC5 is expressed in pancreas, kidney, skeletal muscle, liver, lung, placenta, brain and

Immunogen DnaJ homolog subfamily C member 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to DnaJ heat shock protein family (Hsp40) member C5 beta Sequence MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen DnaJ (Hsp40) homolog, subfamily C, member 5 gamma Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen DnaJ (Hsp40) homolog, subfamily C, member 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen DnaJ (Hsp40) homolog, subfamily C, member 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

DNAJC7 (DnaJ heat shock protein family (Hsp40) member C7) protein has two chaperone-binding TPR (tetratrico peptide repeat region) domains and a DnaJ homologous J domain. It is a cytosolic protein.