Antibody Purification Kit Components

Immunogen DNA replication and sister chromatid cohesion 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen DNA replication and sister chromatid cohesion 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

The gene DSCR3 (Down syndrome critical region protein 3) is mapped to human chromosome 21q22. The gene is present in the locus which participates in the partial or full trisomy of chromosome 21, leading to Down syndrome.

The gene DSCR4 (Down syndrome critical region protein-4) is mapped to human chromosome 21q22.2.

Immunogen desmoglein 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen desmoglein 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Kinetochore-associated protein DSN1 homolog recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Recombinant protein corresponding to DSN1 homolog, MIS12 kinetochore complex component Sequence LSHQERLQSKSLHLSPQEQSASYQDRRQSWRRASMKETNRRKSLHPIHQGITELSRSISVDLAESKRLGCLLLSSFQFSIQKLEPFLRDTKGFSLESFRAKASSLSEELKHFADGLETDGTLQ Application All

Immunogen deltex 3, E3 ubiquitin ligase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

DTX3L (deltex 3 like), also known as BBAP (B-aggressive lymphoma and BAL1 binding partner), is an E3 ubiquitin ligase. This gene localizes to human chromosome 3q21.

Immunogen dual specificity phosphatase 18 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen dual specificity phosphatase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in