-
Add to Cart The item has been addedHPA030479-100ULSigma-Aldrich
Anti-FRK antibody produced in rabbit (C15-1452-714)
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to fyn related Src family tyrosine kinase Sequence RIKRLDEGGFFLTRRRIFSTLNEFVSHYTKTSDGLCVKLGKPCLKIQVPAPFDLSYKTVDQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated -
Add to Cart The item has been addedHPA072590-100ULSigma-Aldrich
ANTI-FRK ANTIBODY PRODUCED IN RABBIT (C15-1466-240)
Price: $977.14List Price: $1,085.71Immunogen fyn related Src family tyrosine kinase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA030347-100ULImmunogen FERM domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA017285-100ULImmunogen FERM domain containing 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA038449-100ULFERM domain containing 4A (FRMD4A) is a member of the four-point-one, ezrin, radixin, moesin (FERM) superfamily of proteins. As the name suggests, the protein contains FERM domain, which is implicated in linking transmembrane proteins to the -
Add to Cart The item has been addedHPA009705-100ULFRMD4B (FERM domain containing 4B) is a highly polymorphic gene localized to human chromosome 3p14.1 and is composed of 24 exons. -
Add to Cart The item has been addedHPA002861-100ULSigma-Aldrich
Anti-FRMD8 antibody produced in rabbit (C15-1445-679)
Price: $879.43List Price: $977.14Immunogen FERM domain-containing protein 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA005506-100ULSigma-Aldrich
Anti-FRMD8 antibody produced in rabbit (C15-1446-372)
Price: $879.43List Price: $977.14Immunogen FERM domain containing 8 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA043141-100ULImmunogen fibronectin type III and SPRY domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
Add to Cart The item has been addedHPA035138-100ULImmunogen fibronectin type III and SPRY domain containing 1-like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA047658-100ULSigma-Aldrich
Anti-FUBP3 antibody produced in rabbit (C15-1459-295)
Price: $928.29List Price: $1,031.43Immunogen far upstream element (FUSE) binding protein 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA058392-100ULSigma-Aldrich
Anti-FUBP3 antibody produced in rabbit (C15-1462-932)
Price: $928.29List Price: $1,031.43Immunogen far upstream element (FUSE) binding protein 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
