Antibody Purification Kit Components

Immunogen glycosyltransferase-like domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen general transcription factor IIIC, polypeptide 1, alpha 220kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen general transcription factor IIIC subunit 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen general transcription factor IIIC, polypeptide 3, 102kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen general transcription factor IIIC, polypeptide 6, alpha 35kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen general transcription factor IIIC, polypeptide 6, alpha 35kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Recombinant protein corresponding to guanylate cyclase activator 1B Sequence GQEFSWEEAEAAGEIDVAELQEWYKKFVMECPSGTLFMHEFKRFFKVTDDEEASQYVEGMFRAFDKNG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated

Guanylate cyclase activator 1C (GUCA1C), also known as guanylate cyclase activating protein 3 (GCAP3), is encoded by the gene mapped to human chromosome 3q13.1.

Application Identification of CD44 positive cells by flow cytometry and immunocytochemistry, in particular with formalin fixed paraffin wax embedded sections of lymphoid and epithelial tissues (high temperature antigen retrieval in 10mM citrate

Immunogen histone cluster 1 H1 family member a Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

IgG&nbspis present in large quantities in the human serum. IgG is composed of glycoproteins, out of which it is 82-96% proteins and 4-18% carbohydrates.

The gene HCLS1 (hematopoietic lineage cell-specific protein) is mapped to human chromosome 3q13. It is present in hematopoietic cells.