Antibody Purification Kits

Immunogen coiled-coil domain containing 94 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen coiled-coil domain containing 94 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

CCNB2 (cyclin B2) is localized to human chromosome 15q22.2.

Immunogen Cyclin-T1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen cyclin T1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Specificity Specifically recognizes mouse CD140a, the alpha chain of PDGF receptor. A receptor tyrosine kinase, PDGFRa forms dimers on the surface upon ligand binding and phosphorylates substrates.

Immunogen Recombinant protein corresponding to CD24 molecule Sequence TTGTSSNSSQSTSNSGLAPNPTNATTKVAGGALQSTASLFVVSLSLLHLYS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Specificity The antibody reacts with the CD24 antigen a heavily glycosylated molecule that migrates as a broad band of 35-45 kDa on both reducing and non-reducing SDS gel electrophoresis. CD24 is attached to the cell membrane via a glycosyl

Specificity This antibody reacts with the 44 kDa antigen found on a sub-population of T cells and activated B cells. These CD28+ CD8 cells are now known to be cytotoxic T cell precursors.

Anti-CD28, mouse monoclonal, clone ANC28.1/5D10, recognizes CD28 on human T cells &amp human CD28 transfected BHK cells.

The gene CD320 is mapped to human chromosome 19.p13.

Specificity The antibody recognizes a heavily glycosylated transmembrane protein: gp 105-120 kDa. The antigen is expressed on immature human haemopoietic precursor cells, capillary endothelial cells and human myeloid cells in the following