-
Add to Cart The item has been addedHPA064747-100ULSigma-Aldrich
Anti-CDC14B antibody produced in rabbit (C15-1464-719)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to cell division cycle 14B Sequence RCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSASNVHY Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
Add to Cart The item has been addedHPA042826-100ULImmunogen cell division cycle 16 homolog ( S. cerevisiae ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
Add to Cart The item has been addedHPA039593-100ULImmunogen cell division cycle 23 homolog ( S. cerevisiae ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
Add to Cart The item has been addedHPA008803-100ULImmunogen cell division cycle 25A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA044130-100ULImmunogen cell division cycle 26 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA028129-100ULSigma-Aldrich
Anti-CDC27 antibody produced in rabbit (C15-1451-720)
Price: $879.43List Price: $977.14Immunogen cell division cycle 27 homolog ( S. cerevisiae ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
Add to Cart The item has been addedHPA052399-100ULSigma-Aldrich
Anti-CDC27 antibody produced in rabbit (C15-1460-997)
Price: $928.29List Price: $1,031.43Immunogen cell division cycle 27 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedAB10620The F-box protein family is characterized by an approximately 40 amino acid motif, the F-box. F-box proteins are divided into 3 classes: FBWs containing WD-40 domains, FBLs containing leucine-rich repeats, and FBXs containing either different -
Add to Cart The item has been addedHPA046620-100ULImmunogen cell division cycle 40 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA069590-100ULImmunogen Recombinant protein corresponding to cell division cycle 42 Sequence NVFDEAILAALEPPETQPKRKCCIF Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA027382-100ULSigma-Aldrich
Anti-CDC42BPG antibody produced in rabbit (C15-1451-466)
Price: $879.43List Price: $977.14Immunogen Serine/threonine-protein kinase MRCK gamma recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA061836-100ULSigma-Aldrich
Anti-CDC42BPG antibody produced in rabbit (C15-1463-925)
Price: $928.29List Price: $1,031.43Immunogen CDC42 binding protein kinase gamma (DMPK-like) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
