Avidin/Streptavidin Biotin Products

Immunogen serine/threonine kinase 35 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen storkhead box 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Storkhead-box protein 1 (STOX1) belongs to forkhead (FOX) family and has winged helix DNA binding domain. It is expressed in three isoforms.

Immunogen storkhead box 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen stimulated by retinoic acid gene 6 homolog (mouse) recombinant protein epitope signature tag (PrEST) Sequence YYTYRNFLKIEVSQSHPAMTAFCSLLLQAQSLLPRTMAAPQDSLRPGEEDEGMQLLQTKDSMAKGARPGASRGRARWGLAYTLLHNPTLQVFRKTALLGANGAQP Application All

Immunogen Striatin-3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

STRN3 (striatin 3) belongs to the striatin sub-family of WD-40 repeat proteins. It is involved in a wide range of physiological processes including signal transduction, cell cycle progression and protein-protein interactions.

Syntaxin 17 (Stx17) is an autophagosomal SNARE (soluble&nbsp N -ethylmaleimide-sensitive factor attachment protein receptor) protein. STX17&nbspis a member of the syntaxin family and is located on human chromosome 9q31.

Immunogen syntaxin 1A (brain) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

STX3 (syntaxin 3) belongs to the syntaxin family with seven isoforms, named as -1A, -1B, -2, -3, -4, -5, and -6. It is composed of a &#945-helical coiled-coil region and a highly hydrophobic region at the extreme carboxyl terminus.

Immunogen Syntaxin-7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Application Atto 590 is a new label with high molecular absorption (120.000) and quantum yield (0.