-
Add to Cart The item has been addedHPA036933-100ULSigma Aldrich
ANTI-STIM2 ANTIBODY PRODUCED IN RABBIT (C15-1454-624)
Price: $1,013.20List Price: $1,125.78Immunogen stromal interaction molecule 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA057511-100ULSigma Aldrich
ANTI-STIM2 ANTIBODY PRODUCED IN RABBIT (C15-1462-676)
Price: $1,013.20List Price: $1,125.78Immunogen stromal interaction molecule 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA018138-100ULImmunogen serine/threonine kinase 17a Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA037979-100ULImmunogen serine/threonine kinase 17a recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA051673-100ULSigma Aldrich
ANTI-STK35 ANTIBODY PRODUCED IN RABBIT (C15-1460-749)
Price: $1,013.20List Price: $1,125.78Immunogen serine/threonine kinase 35 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA026452-100ULImmunogen serine/threonine kinase 35 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA037844-100ULImmunogen storkhead box 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA037845-100ULStorkhead-box protein 1 (STOX1) belongs to forkhead (FOX) family and has winged helix DNA binding domain. It is expressed in three isoforms. -
Add to Cart The item has been addedHPA049776-100ULImmunogen storkhead box 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedHPA040839-100ULImmunogen stimulated by retinoic acid gene 6 homolog (mouse) recombinant protein epitope signature tag (PrEST) Sequence YYTYRNFLKIEVSQSHPAMTAFCSLLLQAQSLLPRTMAAPQDSLRPGEEDEGMQLLQTKDSMAKGARPGASRGRARWGLAYTLLHNPTLQVFRKTALLGANGAQP Application All -
Add to Cart The item has been addedSAB1407867-50UGGeneral description The protein encoded by this gene is a membrane protein involved in the metabolism of retinol. The encoded protein acts as a receptor for retinol/retinol binding protein complexes. -
Add to Cart The item has been addedHPA003392-100ULImmunogen Striatin-3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
