Matched Antibody Pairs

Immunogen Synthetic peptide corresponding to H2A histone family, member Y2. Sequence EKRGRKATSGKKGGK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Recombinant protein corresponding to integrin subunit alpha 2 Sequence ALEAYSETAKVFSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTGIVVDFSENLFFASFSLPV Application All Prestige Antibodies Powered by Atlas Antibodies are developed

Integrin &#945 M (ITGAM) is also called as cluster of differentiation 11b (CD11b), intercellular adhesion molecule-1 (ICAM-1), complement component 3 receptor &#945 chain (CR3&#945), macrophage-1 antigen &#945 subunit or macrophage receptor 1

Immunogen Recombinant protein corresponding to integrin subunit beta 8 Sequence AQHCVNSKGQVCSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCALMEQQHY Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen inter-alpha-trypsin inhibitor heavy chain family, member 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Sry-box 21 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Sry-box 21 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Recombinant protein corresponding to Sry-box 6 Sequence NLDTFEHGGGHSYNHKQIE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to Sry-box 6 Sequence NLDTFEHGGGHSYNHKQIE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

POU2F3 (POU Class 2 Homeobox 3) encodes a member of the POU domain family of transcription factors. POU domain transcription factors bind to a specific octamer DNA motif and regulate cell type-specific differentiation pathways.

POU2F3 (POU Class 2 Homeobox 3) encodes a member of the POU domain family of transcription factors. POU domain transcription factors bind to a specific octamer DNA motif and regulate cell type-specific differentiation pathways.

PrEST Antigen BIRC5 baculoviral IAP repeat containing 5, 100