Premade Western Blots

Cell Line Origin Mouse BALB/c myeloma Cell Line Description Derived from a female BALB/c myeloma tumour MPC-11. The parental cell line has mutated during growth in 6-thioguanine to establish the drug resistant line 45.

Cell Line Origin Human skin fibroblast, SV40 T antigen transformed Cell Line Description Derived from 46BR, a fibroblast from an individual with hypogammaglobulinaemia. The parent line was transformed with the plasmid pSV3gpt expressing SV40

Cell Line Origin Human malignant melanoma IL-1 insensitive Cell Line Description The cell line A375-C5 is unresponsive to the anti-proliferative effect of IL-1. It has been derived from the parental line A373 (Sigma catalogue no.

Cell Line Origin Human Caucasian normal B cell Cell Line Description Normal B cell line of a 72 year old Caucasian male. From the same patient as LUDLU 1 (Sigma Catalogue number.

Nitrocellulose membrane suitable for proteins of a wide range of molecular weights. Low background and excellent signal-to-noise ratios, compatible with a variety of labeling and detection systems, high binding capacicity and proprietary

Nitrocellulose membrane suitable for proteins of a wide range of molecular weights. Low background and excellent signal-to-noise ratios, compatible with a variety of labeling and detection systems, high binding capacicity and proprietary

Immunogen Recombinant protein corresponding to activator of basal transcription 1 Sequence SKKRVVPGIVYLGHIPPRFRPLHVRNLLSAYGEVGRVFFQAEDRFVRRKKKAAAAAGGKKRSYTKDYTEGWVEFR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen ankyrin repeat and BTB (POZ) domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Immunogen ankyrin repeat and BTB (POZ) domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

The gene APOA4 is localized to the long arm of human chromosome 11 along with A1 (APOA1), C3 (APOC3) genes. This gene contains three exons separated by two introns.

APOA4 (apolipoprotein A4) is a major structural elements of lipoproteins, involved in the lipid metabolism. It has two linearly connected four-helix bundles which participate in helix swapping arrangement.

Immunogen Ankyrin repeat and SOCS box protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,