-
HPA042813-100UL
Sigma-Aldrich
Anti-CBWD1 antibody produced in rabbit (C15-1457-387)
Price: $928.29List Price: $1,031.43Immunogen COBW domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA038934-100ULImmunogen chorionic gonadotropin beta subunit 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,
-
HPA008759-100UL
Sigma-Aldrich
Anti-CHGB antibody produced in rabbit (C15-1447-210)
Price: $879.43List Price: $977.14Immunogen Secretogranin-1 precursor recombinant protein epitope signature tag (PrEST) Sequence KQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFERRDNMNDNFLEGEEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDS Application All Prestige -
HPA012602-100UL
Sigma-Aldrich
Anti-CHGB antibody produced in rabbit (C15-1447-808)
Price: $879.43List Price: $977.14Chromogranin B (CHGB) is a water-soluble acidic glycoprotein that is present in almost all endocrine, neuroendocrine and neuronal tissue. It functions as a specific neuroendocrine (NE) marker in cells and tumors. -
HPA061997-100UL
Sigma-Aldrich
Anti-CHMP1B antibody produced in rabbit (C15-1463-957)
Price: $928.29List Price: $1,031.43Immunogen charged multivesicular body protein 1B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA062896-100UL
Sigma-Aldrich
Anti-CHMP1B antibody produced in rabbit (C15-1464-226)
Price: $928.29List Price: $1,031.43Immunogen charged multivesicular body protein 1B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA041401-100UL
Sigma-Aldrich
Anti-CHMP4B antibody produced in rabbit (C15-1456-677)
Price: $928.29List Price: $1,031.43Immunogen chromatin modifying protein 4B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA051751-100UL
Sigma-Aldrich
Anti-CHMP4B antibody produced in rabbit (C15-1460-772)
Price: $928.29List Price: $1,031.43Immunogen charged multivesicular body protein 4B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA051334-100ULImmunogen casein kinase 1, alpha 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
-
HPA059206-100UL
Sigma-Aldrich
Anti-CSNK2A1 antibody produced in rabbit (C15-1463-186)
Price: $928.29List Price: $1,031.43Immunogen casein kinase 2, alpha 1 polypeptide Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA061698-100UL
Sigma-Aldrich
Anti-CSNK2A1 antibody produced in rabbit (C15-1463-882)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to casein kinase 2 alpha 1 Sequence SGPVPSRARVYTDVNTHRPREYWD Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
C8831-.2MLThe cyclin B1 (CCNB1) gene is mapped to human chromosome 5q13.2.