Premade Western Blots

Immunogen BTB (POZ) domain containing 18 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen BTB (POZ) domain containing 19 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen BTB (POZ) domain containing 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Synthetic peptide directed towards the middle region of human BTBD6 Sequence Synthetic peptide located within the following region: GKAFNRCSHLTRHKKIHTAVKRYKCEECGKAFKRCSHLNEHKRVQRGEKS Physical form Purified antibody supplied in 1x

General description Anti-BTBD6 Antibody detects endogenous levels of total BTBD6 protein. Immunogen The antiserum was produced against synthesized peptide derived from human BTBD6.

Immunogen BTB domain containing 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen BTB domain containing 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen BTB (POZ) domain containing 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen basic transcription factor 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen basic transcription factor 3-like 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Butyrophilin, subfamily 1, member A1, a BTN family member, is found in mammary tissue, spleen and thymus. Butyrophilin 1a1 (Btn1a1) is highly expressed in the lactating mammary gland and is secreted into milk in association with lipid droplets.

BTN1A1 (butyrophilin, subfamily 1, member A1) belongs to the BTN gene family, which resides within the major histocompatibility complex class I region on gene 6p22.1.