Premade Western Blots

Immunogen Butyrophilin subfamily 3 member A1 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Mitotic checkpoint protein BUB3 is a protein encoded by the BUB3 gene in humans. In humans, this gene has seven exons and six introns and spans a genomic region of over 16kb.

BVES (blood vessel epicardial substance) is the prototypic member of Popeye Domain Containing (Popdc) family, and is also called POPDC1. This family has two other members called POPDC2 and POPDC3.

Immunogen C4b-binding protein &#945-chain precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen C4b-binding protein &#945-chain precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen complement component 4 binding protein, beta recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Synthetic peptide directed towards the N terminal region of human C4BPB Biochem/physiol Actions C4BPB is a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino

Immunogen COBW domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen COBW domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen chorionic gonadotropin beta subunit 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen Secretogranin-1 precursor recombinant protein epitope signature tag (PrEST) Sequence KQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFERRDNMNDNFLEGEEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDS Application All Prestige

Chromogranin B (CHGB) is a water-soluble acidic glycoprotein that is present in almost all endocrine, neuroendocrine and neuronal tissue. It functions as a specific neuroendocrine (NE) marker in cells and tumors.