Premade Western Blots

Immunogen Recombinant protein corresponding to activator of basal transcription 1 Sequence SKKRVVPGIVYLGHIPPRFRPLHVRNLLSAYGEVGRVFFQAEDRFVRRKKKAAAAAGGKKRSYTKDYTEGWVEFR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen ankyrin repeat and BTB (POZ) domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Immunogen ankyrin repeat and BTB (POZ) domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

The gene APOA4 is localized to the long arm of human chromosome 11 along with A1 (APOA1), C3 (APOC3) genes. This gene contains three exons separated by two introns.

APOA4 (apolipoprotein A4) is a major structural elements of lipoproteins, involved in the lipid metabolism. It has two linearly connected four-helix bundles which participate in helix swapping arrangement.

Immunogen Ankyrin repeat and SOCS box protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen ankyrin repeat and SOCS box containing 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen ankyrin repeat and SOCS box containing 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Synthetic peptide directed towards the middle region of human ASF1B Application Anti-ASF1B antibody produced in rabbit is suitable for western blotting at a concentration of 1&#956g/ml. Biochem/physiol Actions ASF1B [anti-silencing

Immunogen anti-silencing function 1B histone chaperone Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen anti-silencing function 1B histone chaperone Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Synthetic peptide directed towards the N terminal region of human ASS Biochem/physiol Actions ASS catalyzes the penultimate step of the arginine biosynthetic pathway.The protein encoded by this gene catalyzes the penultimate step of the