Premade Western Blots

General description We are committed to bringing you greener alternative products, which adhere to one or more of The 12 Principles of Green Chemistry.This antibody is Preservative-free, produced without the harm or sacrifice of animals and

General description We are committed to bringing you greener alternative products, which adhere to one or more of The 12 Principles of Green Chemistry.This antibody is Preservative-free, produced without the harm or sacrifice of animals and

Ankyrin repeat, SAM and basic leucine zipper domain containing 1 (ASZ1) possesses four ankyrin repeats and the gene encoding it is localized on human chromosome 7q31. Immunogen Ankyrin repeat, SAM and basic leucine zipper domain-containing protein

General description MYB proto-oncogene like 2/v-myb avian myeloblastosis viral oncogene homolog-like 2 (MYBL2/B-MYB) belongs to the MYB family of transcription factors. MYBL2 gene is located on human chromosome 20q13.

B2M (&#946-2-microglobulin) is the invariant light chain of the HLA antigen protein. It is low molecular weight protein.

Immunogen UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

The gene B3GNTL1 (UDP-GlcNAc:&#946Gal &#946-1,3-N-acetylglucosaminyltransferase-like 1) is mapped to human chromosome 17q25.3.

The gene B3GNTL1 (UDP-GlcNAc:&#946Gal &#946-1,3-N-acetylglucosaminyltransferase-like 1) is mapped to human chromosome 17q25.3.

Immunogen Synthetic peptide directed towards the N terminal region of human B4GALNT1 Sequence Synthetic peptide located within the following region: APWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGG Physical form Purified antibody supplied in 1x

B4GALNT1 (&#946-1,4- N -acetyl-galactosaminyl transferase 1) gene localizes to human chromosome 12q, and codes for the enzyme GM synthase. Immunogen &#946-1,4 N-Acetylgalactosaminyltransferase 1 recombinant protein epitope signature tag (PrEST)

B4GALNT1 (&#946-1,4-N-acetyl-galactosaminyl transferase 1) is a GalNAc transferase, and is also called GM2 synthase. This gene is located on human chromosome 12q.