Premade Western Blots

Immunogen Synthetic peptide directed towards the N terminal region of human B4GALNT1 Sequence Synthetic peptide located within the following region: APWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGG Physical form Purified antibody supplied in 1x

B4GALNT1 (&#946-1,4- N -acetyl-galactosaminyl transferase 1) gene localizes to human chromosome 12q, and codes for the enzyme GM synthase. Immunogen &#946-1,4 N-Acetylgalactosaminyltransferase 1 recombinant protein epitope signature tag (PrEST)

B4GALNT1 (&#946-1,4-N-acetyl-galactosaminyl transferase 1) is a GalNAc transferase, and is also called GM2 synthase. This gene is located on human chromosome 12q.

Immunogen beta-1,4-N-acetyl-galactosaminyltransferase 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

B4GALT1 (UDP-Gal:&#946GlcNAc &#946 1,4- galactosyltransferase, polypeptide 1) belongs to a family of type II transmembrane proteins called glycosyltransferases, which resides in Golgi apparatus. This family consists of seven members, from GALT1

B4GALT1 (UDP-Gal:&#946GlcNAc &#946 1,4- galactosyltransferase, polypeptide 1) belongs to a family of type II transmembrane proteins called glycosyltransferases, which resides in Golgi apparatus. This family consists of seven members, from GALT1

B4GALT3 (UDP-Gal:&#946GlcNAc &#946 1,4- galactosyltransferase, polypeptide 3) belongs to a family of seven members, called &#946-1,4-galactosyltransferase (&#946-1,4-GalT). It is expressed in a wide range of human tissues.

Immunogen UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

B3GNT1 (N-acetyllactosaminide &#946-1,3-N-acetylglucosaminyltransferase) is a glycosyltransferase, which is a member of the B3GNT family. It is a type II transmembrane protein, with its transmembrane region composed of 28 amino acids.

B9D1 (B9 protein domain 1) is a component of the “B9” or “tectonic” complex. The complex is present at the ciliary transition zone.