Primary Antibodies

Immunogen Membrane metalloendopeptidase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Membrane metallo-endopeptidase-like 1 recombinant protein epitope signature tag (PrEST) Sequence

Immunogen Membrane metallo-endopeptidase-like 1 recombinant protein epitope signature tag (PrEST) Sequence SVIEKRGSQPLLDILEVVGGWPVAMDRWNETVGLEWELERQLALMNSQFNRRVLIDLFIWNDDQNSSRHIIYIDQPTLGMPSREYYFNGGSNRKVREAYLQFMVSVATLLREDANLPRDSCLVQEDMVQVLEL

All cells within tissues are surrounded by an extracellular matrix (ECM) giving the tissues shape and structure. The ECM is constantly being remodeled and constant communication is maintained between cells through this matrix.

Matrix metallopeptidase 12 (MMP-12) is able to degrade elastin, entactin, laminin-1, fibronectin, type IV collagen as well as insulin B-chain and casein. MMP-12 is structurally similar to the classical MMPs (MMP-1, MMP-3) it contains a propeptide

Specificity The antibody recognizes native and recombinant proteins. Immunogen Catalytic domain of MT1-MMP Application Anti-MMP-14 Antibody detects level of MMP-14 &amp has been published &amp validated for use in ELISA, FC, IP, WB &amp IC.

MMP-3 (matrix metalloproteinase-3), also known as stromelysin-1, is a member of the matrix metalloproteinase (MMP) family of zinc endopeptidases. MMP&#8217s are required for removal of extracellular matrix machinery during embryo development,

MMP-3 (matrix metalloproteinase-3), also known as stromelysin-1, is a member of the matrix metalloproteinase (MMP) family of zinc endopeptidases. MMP&#8217s are required for removal of extracellular matrix machinery during embryo development,

All cells within tissues are surrounded by an extracellular matrix (ECM) giving the tissues shape and structure. The ECM is constantly being remodeled and constant communication is maintained between cells through this matrix.

All cells within tissues are surrounded by an extracellular matrix (ECM) giving the tissues shape and structure. The ECM is constantly being remodeled and constant communication is maintained between cells through this matrix.

Immunogen matrix metallopeptidase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen matrix metallopeptidase 11 (stromelysin 3) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive