-
AV32134-100UL
Anti-MyF5 antibody produced in rabbit
Price: $898.29List Price: $998.10MyF5 (MyoD) regulates the determination of skeletal myoblasts during embryonic development. Inactivation of MyF5 in mice results in abnormal development of the ribs, which eventually leads to perinatal death. -
HPA062391-100UL
Anti-MYH14 antibody produced in rabbit (C15-1464-062)
Price: $928.29List Price: $1,031.43Immunogen myosin, heavy chain 14, non-muscle Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA067889-100UL
Anti-MYH14 antibody produced in rabbit (C15-1465-392)
Price: $928.29List Price: $1,031.43Immunogen myosin, heavy chain 14, non-muscle Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA070260-100UL
Anti-MYH14 antibody produced in rabbit (C15-1465-813)
Price: $928.29List Price: $1,031.43Immunogen myosin, heavy chain 14, non-muscle Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA034871-100UL
Anti-MYH15 antibody produced in rabbit (C15-1453-598)
Price: $889.20List Price: $988.00Immunogen myosin, heavy chain 15 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA057915-100UL
ANTI-MYH15 ANTIBODY PRODUCED IN RABBIT (C15-1462-781)
Price: $977.14List Price: $1,085.71Immunogen myosin heavy chain 15 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA073827-100UL
ANTI-MYL1 ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen myosin light chain 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA013331-100UL
Anti-MYL7 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Myosin regulatory light chain 2, atrial isoform recombinant protein epitope signature tag (PrEST) Application Anti-MYL7 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project -
HPA078501-100UL
Anti-MYO15A antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to myosin XVA Sequence LHPHLTRFLQDVSRTPGLPFQGIAKACEQNLQKTLRFGGRLELPSSIELRAMLAGRSSKRQLFLLPGGLERHLKIKTCTVALDVVEEICAEMA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
HPA040110-100UL
Anti-MYO16 antibody produced in rabbit (C15-1456-068)
Price: $928.29List Price: $1,031.43Immunogen myosin XVI recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA058769-100UL
Anti-MYO16 antibody produced in rabbit (C15-1463-047)
Price: $928.29List Price: $1,031.43Immunogen myosin XVI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
HPA071948-100UL
Anti-MYO16 antibody produced in rabbit (C15-1466-141)
Price: $928.29List Price: $1,031.43Immunogen myosin XVI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The