-
Add to Cart The item has been addedHPA035206-100ULAnti-NAGK antibody produced in rabbit (C15-1453-746)
Price: $928.29List Price: $1,031.43Immunogen N-acetylglucosamine kinase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA035207-100ULAnti-NAGK antibody produced in rabbit (C15-1453-747)
Price: $928.29List Price: $1,031.43Immunogen N-acetylglucosamine kinase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedAB15115Anti-NARC-1 Antibody (C15-1315-724)
Price: $828.00List Price: $920.00Specificity Neural apoptosis-regulated convertase 1 [NARC-1, Pcsk9]. By Western blot the antibody recognizes a doublet at ~76 kDa in mouse liver lysate. -
Add to Cart The item has been addedHPA047187-100ULAnti-NAT14 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen N-acetyltransferase 14 (GCN5-related, putative) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA007394-100ULAnti-NBL1 antibody produced in rabbit
Price: $879.43List Price: $977.14NBL1 (neuroblastoma 1, DAN family BMP antagonist) gene is localized to human chromosome 1p36.13. -
Add to Cart The item has been addedHPA030766-100ULAnti-NCK1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen NCK adaptor protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedAB15300Anti-NECL-1 Antibody (C15-1315-746)
Price: $804.00List Price: $893.33Nectins are immunoglobulin superfamily adhesion molecules that participate in the organization of epithelial and endothelial junctions. Human and mouse NECL1 share 87. -
Add to Cart The item has been addedHPA020873-100ULAnti-NEK1 antibody produced in rabbit (C15-1449-683)
Price: $879.43List Price: $977.14The gene NEK1 (never in mitosis A-related kinase 1) is mapped to human chromosome 4q33. The protein localizes in the cytoplasm and mitochondria. -
Add to Cart The item has been addedHPA040413-100ULAnti-NEK1 antibody produced in rabbit (C15-1456-191)
Price: $928.29List Price: $1,031.43Immunogen NIMA (never in mitosis gene a)-related kinase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
Add to Cart The item has been addedHPA016908-100ULAnti-NEK11 antibody produced in rabbit
Price: $879.43List Price: $977.14NEK11 (NIMA-related kinase 11) is a checkpoint-associated protein kinase belonging to the NIMA (never in mitosis gene A) family. It is localized at the nucleoli. -
Add to Cart The item has been addedHPA015750-100ULAnti-NEK4 antibody produced in rabbit (C15-1448-440)
Price: $879.43List Price: $977.14Immunogen Serine/threonine-protein kinase Nek4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA058543-100ULAnti-NEK4 antibody produced in rabbit (C15-1462-981)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to NIMA related kinase 4 Sequence YGEGKGQTNEINALVQLMTQTLKLDSKESCEDVPVANPVSEFKLHRKYRDTLILHGKVAEEAEEIHFKELPSAIMPGSEKIRRLVEVLRTDVIRG Application All Prestige Antibodies Powered by Atlas Antibodies are
